Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G141800.1
Common NamePOPTR_0015s13340g
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 754aa    MW: 83020.4 Da    PI: 5.9077
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G141800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r+k  ++t++q++eLe++F+++++p++++r eL+++lgL+ +q+k+WFqNrR+++k
                         79999************************************************999 PP

               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                         la++a++el+k a++e+p W ks     e +n +e++++f++  +     + +ea r+sgvv +++ +lve+l+d++  W e+++    +a
                         6899**********************9999************999999999**************************.************* PP

               START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                         +t++ +ssg      galq + ae+q++sp vp R + f+R ++ql +g+w+++dvSvd +q++ + +  v +++lpSg++i+++ ng +k
                         ****************************************************************999999999****************** PP

               START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                         vtwveh +++++ +h l+r++++sg+ +ga++w a+lqr+ e
                         ***************************************977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.25355115IPR001356Homeobox domain
SMARTSM003891.5E-1857119IPR001356Homeobox domain
PfamPF000462.9E-1858113IPR001356Homeobox domain
CDDcd000869.73E-1958115No hitNo description
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
PROSITE profilePS5084839.624253489IPR002913START domain
SuperFamilySSF559615.92E-32254485No hitNo description
CDDcd088752.40E-114257485No hitNo description
SMARTSM002341.6E-40262486IPR002913START domain
PfamPF018522.6E-49263485IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-4326483IPR023393START-like domain
SuperFamilySSF559611.59E-15514749No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011048683.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLB9ID610.0B9ID61_POPTR; Uncharacterized protein
STRINGPOPTR_0015s13340.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein